Please login to your online account to display your discounted pricing

anti-ATAD2, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP1-84123

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP184123

  • / Each
 

Description & Specifications

Specifications

Antigen ATAD2
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Conjugate Unlabeled
Cross Reactivity Human
Format Affinity Purified
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Accession No. Q6PL18
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
Quantity 0.1mL
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 29028
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Possible cross-reactivity based on sequence identity: Mouse (82%), Rat (82%).