Please login to your online account to display your discounted pricing

anti-ATAD2, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP184123

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP184123

  • / Each
 

Description & Specifications

Specifications

Primary or Secondary Primary
Gene Accession No. Q6PL18
Monoclonal or Polyclonal Polyclonal
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Possible cross-reactivity based on sequence identity: Mouse (82%), Rat (82%).
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Antigen ATAD2
Formulation PBS, pH 7.2, containing 40% glycerol
Gene ID (Entrez) 29028
Format Affinity Purified
Quantity 0.1mL
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
Host Species Rabbit
Regulatory Status RUO
Conjugate Unlabeled
Cross Reactivity Human