Please login to your online account to display your discounted pricing

anti-Annexin A10, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP190156

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP190156

  • / Each
 

Description & Specifications

Specifications

Conjugate Unlabeled
Formulation PBS, pH 7.2, containing 40% glycerol
Host Species Rabbit
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Gene ID (Entrez) 11199
Gene Accession No. Q9UJ72
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Cross Reactivity Human
Antigen Annexin A10
Format Affinity Purified
Regulatory Status RUO
Monoclonal or Polyclonal Polyclonal
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK
Quantity 0.1mL