missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

ACBD5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals Canada NBP159820

 View more versions of this product

Catalog No. NBP159820




ACBD5, Host-Rabbit, WB, Hu, Polyclonal, Primary, Antibody, 100μL, Unlabeled, Novus Biologicals

ACBD5 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Description & Specifications


PBS and 2% Sucrose
acyl-CoA binding domain containing 5, acyl-Coenzyme A binding domain containing 5, DKFZp434A2417, endozepine-related protein, KIAA1996acyl-CoA-binding domain-containing protein 5, membrane-associated diazepam binding inhibitor
Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5). The peptide sequence was selected from the N-terminal of ACBD5. Peptide sequence ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK.
Store at -20°C. Avoid freeze-thaw cycles.
Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Equine: 92%.
Western Blot
Affinity Purified
Immunogen affinity purified
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.