Please login to your online account to display your discounted pricing

ACBD5 Rabbit anti-Human, Polyclonal, Novus Biologicals™


Rabbit Polyclonal Antibody

Manufacturer: novus biologicals canada  NBP159820

 View more versions of this product

Catalog No. NBP159820

  • / Each
 

Description & Specifications

Specifications

Storage Requirements Store at -20°C. Avoid freeze-thaw cycles.
Quantity 100μL
Formulation PBS and 2% Sucrose
Gene ID (Entrez) 91452
Immunogen Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5). The peptide sequence was selected from the N-terminal of ACBD5. Peptide sequence ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK.
Species Reactivity Human
Purification Method Immunogen affinity purified
Gene Alias acyl-CoA binding domain containing 5, acyl-Coenzyme A binding domain containing 5, DKFZp434A2417, endozepine-related protein, KIAA1996acyl-CoA-binding domain-containing protein 5, membrane-associated diazepam binding inhibitor
Conjugate Unlabeled
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Primary or Secondary Primary
Gene Accession No. Q5T8D3
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Equine: 92%.
Cross Reactivity Bovine
Cross Reactivity Canine
Cross Reactivity Equine
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Rabbit
Cross Reactivity Rat
Format Affinity Purified
Host Species Rabbit
Applications Western Blotting
Antigen ACBD5
Monoclonal or Polyclonal Polyclonal
Regulatory Status RUO

ACBD5 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.