Please login to your online account to display your discounted pricing

anti-ACBD5, Polyclonal, Novus Biologicals™

$367.12 - $461.00

Specifications

Host Species Rabbit
Immunogen Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5) The peptide sequence was selected from the C terminal of ACBD5. Peptide sequence VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR.
Antigen ACBD5
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Conjugate Quantity Price Quantity    

NBP159821

 
novus biologicals canada
NBP159821
Unlabeled 0.05mg Each for $367.12

NBP185146

 
novus biologicals canada
NBP185146
Unlabeled 0.1mL Each for $461.00
Description & Specifications

Specifications

Host Species Rabbit
Immunogen Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5) The peptide sequence was selected from the C terminal of ACBD5. Peptide sequence VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR.
Antigen ACBD5
Monoclonal or Polyclonal Polyclonal
Format Affinity Purified
Primary or Secondary Primary
Regulatory Status RUO
Applications Western Blotting
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%; Canine: 92%; Equine: 92%; Rabbit: 92%; Xenopus: 78%.
Gene Accession No. Q5T8D3
Gene ID (Entrez) 91452
Formulation PBS and 2% Sucrose Lyophilized with the antibody.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.