Please login to your online account to display your discounted pricing

anti-ACBD5, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP1-85145

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP185145

  • / Each
 

Description & Specifications

Specifications

Antigen ACBD5
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Conjugate Unlabeled
Cross Reactivity Human
Format Affinity Purified
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Accession No. Q5T8D3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPM
Quantity 0.1mL
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 91452
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.