Please login to your online account to display your discounted pricing

anti-ACBD5, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP185145

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP185145

  • / Each
 

Description & Specifications

Specifications

Gene Accession No. Q5T8D3
Formulation PBS, pH 7.2, containing 40% glycerol
Conjugate Unlabeled
Cross Reactivity Human
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 91452
Format Affinity Purified
Antigen ACBD5
Host Species Rabbit
Quantity 0.1mL
Regulatory Status RUO
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPM