Please login to your online account to display your discounted pricing

anti-ACBD5, Polyclonal, Novus Biologicals™

Manufacturer: novus biologicals canada  NBP1-59821

 View more versions of this product


For Research Use Only

Catalog No. NBP159821

  • / Each

Description & Specifications


Antigen ACBD5
Applications Western Blotting
Conjugate Unlabeled
Cross Reactivity Bovine
Cross Reactivity Canine
Cross Reactivity Equine
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Rabbit
Cross Reactivity Rat
Format Affinity Purified
Formulation PBS and 2% Sucrose Lyophilized with the antibody.
Gene Accession No. Q5T8D3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5) The peptide sequence was selected from the C terminal of ACBD5. Peptide sequence VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR.
Quantity 0.05mg
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 91452
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%; Canine: 92%; Equine: 92%; Rabbit: 92%; Xenopus: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.