Please login to your online account to display your discounted pricing

ACBD5 Rabbit anti-Human, Polyclonal, Novus Biologicals™


Rabbit Polyclonal Antibody

Manufacturer: novus biologicals canada  NBP159821

 View more versions of this product

Catalog No. NBP159821

  • / Each
 

Description & Specifications

Specifications

Antigen ACBD5
Applications Western Blot
Conjugate Unlabeled
Format Affinity Purified
Formulation PBS and 2% Sucrose
Gene Accession No. Q5T8D3
Gene Alias acyl-CoA binding domain containing 5, acyl-Coenzyme A binding domain containing 5, DKFZp434A2417, endozepine-related protein, KIAA1996acyl-CoA-binding domain-containing protein 5, membrane-associated diazepam binding inhibitor
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5). The peptide sequence was selected from the C-terminal of ACBD5. Peptide sequence VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR.
Purification Method Immunogen affinity purified
Quantity 100μL
Regulatory Status RUO
Storage Requirements Store at -20°C. Avoid freeze-thaw cycles.
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 91452
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%; Canine: 92%; Equine: 92%; Rabbit: 92%; Xenopus: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human

ACBD5 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.