Please login to your online account to display your discounted pricing

anti-ACBD5, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP159821

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP159821

  • / Each
 

Description & Specifications

Specifications

Monoclonal or Polyclonal Polyclonal
Gene Accession No. Q5T8D3
Gene ID (Entrez) 91452
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Formulation PBS and 2% Sucrose Lyophilized with the antibody.
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%; Canine: 92%; Equine: 92%; Rabbit: 92%; Xenopus: 78%.
Conjugate Unlabeled
Quantity 0.05mg
Cross Reactivity Bovine
Cross Reactivity Canine
Cross Reactivity Equine
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Rabbit
Cross Reactivity Rat
Format Affinity Purified
Regulatory Status RUO
Antigen ACBD5
Primary or Secondary Primary
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5) The peptide sequence was selected from the C terminal of ACBD5. Peptide sequence VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR.
Applications Western Blotting