Please login to your online account to display your discounted pricing

ACBD5 Rabbit anti-Human, Polyclonal, Novus Biologicals™


Rabbit Polyclonal Antibody

Manufacturer: novus biologicals canada  NBP159821

 View more versions of this product

Catalog No. NBP159821

  • / Each
 

Description & Specifications

Specifications

Gene ID (Entrez) 91452
Formulation PBS and 2% Sucrose
Storage Requirements Store at -20°C. Avoid freeze-thaw cycles.
Purification Method Immunogen affinity purified
Quantity 100μL
Immunogen Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5). The peptide sequence was selected from the C-terminal of ACBD5. Peptide sequence VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR.
Species Reactivity Human
Gene Alias acyl-CoA binding domain containing 5, acyl-Coenzyme A binding domain containing 5, DKFZp434A2417, endozepine-related protein, KIAA1996acyl-CoA-binding domain-containing protein 5, membrane-associated diazepam binding inhibitor
Monoclonal or Polyclonal Polyclonal
Gene Accession No. Q5T8D3
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 92%; Canine: 92%; Equine: 92%; Rabbit: 92%; Xenopus: 78%.
Conjugate Unlabeled
Cross Reactivity Bovine
Cross Reactivity Canine
Cross Reactivity Equine
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Rabbit
Cross Reactivity Rat
Format Affinity Purified
Regulatory Status RUO
Antigen ACBD5
Primary or Secondary Primary
Host Species Rabbit
Applications Western Blotting

ACBD5 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.