missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

apoptosis antagonizing transcription factor, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant AATF.

Supplier:  Abnova Corporation H00026574A01

Catalog No. 89-004-591



Description

Description

The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. [provided by RefSeq

Sequence: VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT
Specifications

Specifications

apoptosis antagonizing transcription factor
Polyclonal
Mouse polyclonal antibody raised against a partial recombinant AATF.
AATF
CHE-1/CHE1/DED
Mouse
50 μL
Apoptosis
Primary
Human, Rat
Serum
ELISA, Western Blot
Unconjugated
50% glycerol
BC000591
AATF
AATF (AAH00591, 151 a.a. ∼ 250 a.a) partial recombinant protein with GST tag.
RUO
Yes
26574
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
SDS
Documents

Documents

Promotions

Promotions