Please login to your online account to display your discounted pricing

anti-5'-Nucleotidase/CD73, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP185740

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP185740

  • / Each
 

Description & Specifications

Specifications

Gene ID (Entrez) 4907
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Accession No. P21589
Monoclonal or Polyclonal Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Reactivity to Mouse and Rat determined by Western Blot.. Porcine reactivity reported in customer review.
Host Species Rabbit
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Porcine
Cross Reactivity Rat
Antigen 5'-Nucleotidase/CD73
Quantity 0.1mL
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
Regulatory Status RUO
Conjugate Unlabeled
Format Affinity Purified