missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

anti-5'-Nucleotidase/CD73, Polyclonal, Novus Biologicals™

Manufacturer:  Novus Biologicals Canada NBP185740

 View more versions of this product

Catalog No. NBP185740


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

5'-Nucleotidase/CD73
Unlabeled
P21589
Rabbit
0.1mL
Primary
4907
Human,Murine,Porcine,Rat
Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Paraffin),Western Blot
PBS, pH 7.2, containing 40% glycerol
Affinity Purified
This antibody was developed against Recombinant Protein corresponding to amino acids:EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
RUO
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Reactivity to Mouse and Rat determined by Western Blot.. Porcine reactivity reported in customer review.