Please login to your online account to display your discounted pricing

anti-5'-Nucleotidase/CD73, Polyclonal, Novus Biologicals™


Manufacturer: novus biologicals canada  NBP1-85740

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP185740

  • / Each
 

Description & Specifications

Specifications

Antigen 5'-Nucleotidase/CD73
Applications Immunocytochemistry
Applications Immunofluorescence
Applications Immunohistochemistry
Applications Immunohistochemistry (Paraffin)
Applications Western Blotting
Conjugate Unlabeled
Cross Reactivity Human
Cross Reactivity Mouse
Cross Reactivity Porcine
Cross Reactivity Rat
Format Affinity Purified
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Accession No. P21589
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
Quantity 0.1mL
Regulatory Status RUO
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
Gene ID (Entrez) 4907
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. Reactivity to Mouse and Rat determined by Western Blot.. Porcine reactivity reported in customer review.