missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

For use in research applications

Manufacturer:  Novus Biologicals™ NBP2293325MG

 View more versions of this product

Catalog No. NBP2293325


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

5mg
Inhibition of Akt kinase activity
AKT1/2/3
Lyophilized
Human
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
AKT1/2/3 Inhibitor Peptide Set
4214
Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361