Please login to your online account to display your discounted pricing

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

For use in research applications

Manufacturer: novus biologicals™  NBP2-29332-5MG

 View all options for this product

Catalog No. NBP2293325

Description & Specifications

Product Type AKT1/2/3 Inhibitor Peptide Set
Format Lyophilized
Inhibitors AKT1/2/3
Molecular Weight 4214
Includes Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Quantity 5mg
For Use With (Application) Inhibition of Akt kinase activity
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.