Please login to your online account to display your discounted pricing

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set


For use in research applications

Manufacturer: novus biologicals™  NBP229332

 View more versions of this product

 Disclaimers

For Research Use Only

Catalog No. NBP229332

  • / Each
 

Description & Specifications

Specifications

Quantity 2mg
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Inhibitors AKT1/2/3
Host Species Human
For Use With (Application) Inhibition of Akt kinase activity
Product Type AKT1/2/3 Inhibitor Peptide Set
Includes Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Format Lyophilized
Molecular Weight 4214