missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

For use in research applications

Manufacturer:  Novus Biologicals™ NBP229332

 View more versions of this product

Catalog No. NBP229332


 

Disclaimers:

For Research Use Only


Specifications Description & Specifications

Specifications

AKT1/2/3 Inhibitor Peptide Set
Human
4214
2mg
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Lyophilized
AKT1/2/3
Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Inhibition of Akt kinase activity