missing translation for 'onlineSavingsMsg'
Learn More
Please login to your online account to display your discounted pricing

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

For use in research applications

$472.00 - $948.07

Specifications

Product Type AKT1/2/3 Inhibitor Peptide Set
Host Species Human
Inhibitors AKT1/2/3
Molecular Weight 4214
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
View More Specs

Disclaimers:

For Research Use Only



Products ${productFamilyLength}
Catalog Number Mfr. No. Quantity Price Quantity  
Catalog Number Mfr. No. Quantity Price Quantity  
NBP229332 Novus Biologicals™
NBP229332
2mg Each for $472.00
NBP2293325 Novus Biologicals™
NBP2293325MG
5mg Each for $948.07
Specifications Description & Specifications

Specifications

AKT1/2/3 Inhibitor Peptide Set
AKT1/2/3
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Inhibition of Akt kinase activity
Human
4214
Lyophilized
Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361