Please login to your online account to display your discounted pricing

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set

For use in research applications

$461.00 - $966.00

Specifications

Product Type AKT1/2/3 Inhibitor Peptide Set
Inhibitors AKT1/2/3
Molecular Weight 4214
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Format Lyophilized
View More Specs

 Disclaimers

For Research Use Only

Products
Catalog Number Mfr. No. Quantity Price Quantity    

NBP229332

 
novus biologicals™
NBP2-29332
2mg Each for $461.00

NBP2293325

 
novus biologicals™
NBP2-29332-5MG
5mg Each for $966.00
Description & Specifications

Specifications

Product Type AKT1/2/3 Inhibitor Peptide Set
Inhibitors AKT1/2/3
Molecular Weight 4214
Storage Requirements Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Format Lyophilized
For Use With (Application) Inhibition of Akt kinase activity
Includes Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361