LAG1 homolog, ceramide synthase 6, Mouse, Clone: 6B8, Abnova™

Name: LAG1 homolog, ceramide synthase 6, Mouse, Clone: 6B8, Abnova&trade;
Brand: Abnova Corporation
SKU: 89-001-409
Price: 392.20 CAD

Mouse monoclonal antibody raised against a partial recombinant LASS6.

Supplier: Abnova Corporation H00253782M02

Catalog No. 89-001-409

Quantity

Description

Sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR

Specifications

Antigen	LAG1 homolog, ceramide synthase 6
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_203463
Gene Symbols	LASS6
Immunogen	LASS6 (NP_982288, 62 a.a. ∼ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Whole Molecule	Yes
Gene ID (Entrez)	253782
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2b κ

Applications	ELISA, Western Blot
Clone	6B8
Description	Mouse monoclonal antibody raised against a partial recombinant LASS6.
Gene	LASS6
Gene Alias	CerS6/MGC129949/MGC129950
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Rat
Product Type	Antibody

Description