Browse Results : 537580 Item(s)
  1. 1
  2. 2
  3. 3
  4. 4
  5. 5
  6. >
  7. >>
 
1 Aushon CiraScan™ Imaging and Analysis System
Complete system includes an improved CCD imager with custom optics designed specifically for quantitative chemiluminescent protein arrays
2 Aushon Chemiluminescent iMac™ with Microsoft™ Office and PROArray™ Software
For use with the Aushon Cirascan Imaging and Analysis System
3 1,6-Dimethoxyhexane, 98%, Alfa Aesar™
13179-98-1 CH3O(CH2)6OCH3 1,6-Dimethoxyhexane
4 Aushon Cirasoft™ Analyst Software
Offers the flexibility to analyze both small and large protein arrays
5 anti-APOBEC2, Polyclonal, Novus Biologicals™
6 MEMBRANE BLOCKING SOLUTION
MEMBRANE BLOCKING SOLUTION
7 CLAMP ST METAL SZ 24
CLAMP ST METAL SZ 24
8 anti-APOBEC2, Polyclonal, Novus Biologicals™
Host Species: RabbitSpecies Reactivity: HumanImmunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYV...
9 Mouse sVEGF R3/Flt-4 DuoSet™, R&D Systems™
Assay Type: ELISA Development KitCross Reactivity:
10 5-Hexynoic acid, 97%, Alfa Aesar™
53293-00-8 HCºC(CH2)3CO2H 5-Hexynoic acid
 

  1. 1
  2. 2
  3. 3
  4. 4
  5. 5
  6. >
  7. >>