Browse Results : 534102 Item(s)
  1. 1
  2. 2
  3. 3
  4. 4
  5. 5
  6. >
  7. >>
 
1 Aushon CiraScan™ Imaging and Analysis System
Complete system includes an improved CCD imager with custom optics designed specifically for quantitative chemiluminescent protein arrays
2 Aushon Chemiluminescent iMac™ with Microsoft™ Office and PROArray™ Software
For use with the Aushon Cirascan Imaging and Analysis System
3 3-Fluoro-5-methylbenzylamine, 97%, Alfa Aesar™
771573-02-5 C8H10FN 3-Fluoro-5-methylbenzylamine
4 Aushon Cirasoft™ Analyst Software
Offers the flexibility to analyze both small and large protein arrays
5 anti-GTPBP5, Polyclonal, Novus Biologicals™
Host Species: RabbitSpecies Reactivity: HumanImmunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:NGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPV
6 4-Fluoro-2-(trifluoromethyl)phenylacetic acid, 97%, Alfa Aesar™
195447-80-4 C9H6F4O2 4-Fluoro-2-(trifluoromethyl)phenylacetic acid
7 MEMBRANE BLOCKING SOLUTION
MEMBRANE BLOCKING SOLUTION
8 CLAMP ST METAL SZ 24
CLAMP ST METAL SZ 24
9 anti-HAPLN2, Polyclonal, Novus Biologicals™
10 Mouse IL-12 (total) ELISA Kits, Thermo Scientific™
Microplate kits for sandwich ELISA of total mouse interleukin-12 (IL-12, p70 plus p40)
 

  1. 1
  2. 2
  3. 3
  4. 4
  5. 5
  6. >
  7. >>